PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013890549.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family WRKY
Protein Properties Length: 380aa    MW: 37742.5 Da    PI: 4.2453
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013890549.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY795.3e-25335378245
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSST CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedp 45 
                     dDgy+WrKYGqK+vkg+++prsYY+Ct+++C+v+k+ve s++d 
  XP_013890549.1 335 DDGYKWRKYGQKTVKGNPNPRSYYKCTHPHCSVRKHVEVSSDDH 378
                     8****************************************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182902.35E-21328378IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.3E-23329379IPR003657WRKY domain
PROSITE profilePS5081123.652329380IPR003657WRKY domain
SMARTSM007744.6E-19334380IPR003657WRKY domain
PfamPF031063.9E-19335377IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MMAALQGMGG MGGMGGMGGM GGMGGMGGMP MSLMMPQLQQ PAPDADVAPT SGGGGGAPED  60
GAAAAAAGPP DGGHDAGPGE RAAAAVAAAA AAAEAAGERE NGEEQAAATP SGMAVDEEEG  120
AEGQVAPEEQ QQQQQQQRRP RQQQGGEEIE CDEGLDSGEG DEQRRAGGGG ADAEADGEQR  180
NGAAAGGDGE GADGGGPTPR AHKRERSGGP GDDQAPHAGA LLAPHLQPMT PSLMGAFMNP  240
MLGPMGQMQM MGPGGLQLGM GPMGGPMFPA MLGPMGGGLM GPGDMAMALA MGGGPHGGEE  300
DDEDDMGGGG GGRGEMYHGG EGGSLSRLVD LSSADDGYKW RKYGQKTVKG NPNPRSYYKC  360
THPHCSVRKH VEVSSDDHSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-163353771557WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013890549.10.0putative WRKY transcription factor 2, partial
TrEMBLA0A0D2LHM00.0A0A0D2LHM0_9CHLO; Putative WRKY transcription factor 2 (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4691626
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.14e-19WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]